Avatar
MMP 2 (Progelatinase A) (Recombinant Protein)
from  biotez
Buy in shop online

30 100 602 Catalog number

10 µg/ 50µl Size

230 € Price

More details

Protein type

Recombinant

Protein subtype

EC 3.4.24.24

Protein family

Matrix Metalloproteinases, matrixins

Protein description

MMP2 is a ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly- -Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.

Research area interests

Diseases associated with MMP2 include Multicentric Osteolysis, Nodulosis, And Arthropathy and Multicentric Osteolysis Of Torg. Among its related pathways are Pathways in cancer and Integrin Pathway

Package form

liquid

Tested applications

Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard

Other names

Matrix Metalloproteinase 2, Progelatinase A, a 72kDa Type IV Collagenase

Peptide sequence

MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Available target modification

No

Expression system

Insect Cell

Product Subtype

full length

Active form?

Yes, after APMA activation

Tag

untagged

Contents

50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35

Protein purity

> 95 %

Molecular weight

72 kDa

UniProt number

P08253

Gene number

4313

Abbreviation

MMP2

Full name

matrix metallopeptidase 2

Other desciption

MMP2 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.

Purification

Mentioned in the data sheet

PubMed citations

See the data sheet

Warnings

For Research Use only.

Shipping conditions

dry ice

Storage condition

Store at -70°C

Technical datasheet

Contact us to receive the datasheet

Source

Recombinants or rec. proteins

Group

recombinants