Avatar
MMP 14 (MT1-MMP) prodomain, catalytic domain, and hemopexin domain, His-tagged (Recombinant Protein)
from  biotez
Buy in shop online

30 100 122 Catalog number

10 µg/ 50µl Size

340 € Price

More details

Protein type

Recombinant

Protein subtype

EC 3.4.24.80

Protein family

Matrix Metalloproteinases, matrixins

Protein description

MMP14 seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.

Research area interests

Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Signaling events mediated by focal adhesion kinase and Adhesion

Package form

liquid

Tested applications

Investigation of MT1-MMP; Generation of active MT1-MMP for progelatinase A activation; Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard

Other names

Membrane-Type-1 Matrix Metalloproteinase

Peptide sequence

SLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVTHHHHHH

Available target modification

No

Expression system

E.coli

Product Subtype

protein fragment

Active form?

No

Tag

His-tagged

Contents

50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2.

Protein purity

> 80 %

Molecular weight

58 kDa

UniProt number

P50281

Gene number

4323

Abbreviation

MMP14

Full name

matrix metallopeptidase 14

Other desciption

Recombinant soluble pro-MT1-MMP is produced as a periplasmic protein in E. coli. The protein contains prodomain, catalytic domain and hemopexin domain of MT1-MMP

Purification

Mentioned in the data sheet

PubMed citations

See the data sheet

Warnings

For Research Use only.

Shipping conditions

dry ice

Storage condition

Store at -70°C

Technical datasheet

Contact us to receive the datasheet

Conjugation

histidine

Source

Recombinants or rec. proteins

Group

recombinants